(data stored in ACNUC7421 zone)

EMBL: CP001630.PE46

CP001630.PE46        Location/Qualifiers
FT   CDS             49586..51220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0046"
FT                   /product="nuclease (RecB family)-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34020"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR019993"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCJ9"
FT                   /inference="protein motif:COG:COG2251"
FT                   /protein_id="ACU34020.1"
FT                   /translation="MTSQVQLDAGVVTRCRRRVHLEHDPDVREAAKAPPDAAGQQRRAD
FT                   AVDHRAAVARALGREVGSALVEVPPDVPVADRERVTAEAMRVGAEYIWGAVLPRDPRGG
FT                   RKGGVELLVRDRTGYVPVIVVRHKTTDPGHGARTSPLSYPQPAGARTDPVRKVRPQPRD
FT                   QLRLAHVQRLLQASGHAAPGRATGGAIGMDADVVVWHDLEAATWPGGRTALSEYDARFA
FT                   DRLAIADAAIAGTSPLARPSRVVECKTCPWWPVCSDALTQARDVSLVVRGEDAMALRRA
FT                   GVPTVDDLAALDPAEPAVPLVGMAHEDAVVLARAWLRGLAVARRVPRIEVARAEVEVDV
FT                   DMESFGDLGAYMWGCLLSGADVGVEPGYRAFATWDKLPCADEARSFAEFWAWLTGVRRA
FT                   AAERGLGFKAYCYNELAENRWLLSSAQRFKGQPGVPPVAEVKEFITSDDWVDLFGVVRD
FT                   QFLSTNGKGLKTIAPLAGFHWRDPEAGGENSMRWYRDAVGMDGQEPDPAQRRRLLEYNE
FT                   DDVRATHALRGWMTSDAVAGLPYAGDL"
     MTSQVQLDAG VVTRCRRRVH LEHDPDVREA AKAPPDAAGQ QRRADAVDHR AAVARALGRE        60
     VGSALVEVPP DVPVADRERV TAEAMRVGAE YIWGAVLPRD PRGGRKGGVE LLVRDRTGYV       120
     PVIVVRHKTT DPGHGARTSP LSYPQPAGAR TDPVRKVRPQ PRDQLRLAHV QRLLQASGHA       180
     APGRATGGAI GMDADVVVWH DLEAATWPGG RTALSEYDAR FADRLAIADA AIAGTSPLAR       240
     PSRVVECKTC PWWPVCSDAL TQARDVSLVV RGEDAMALRR AGVPTVDDLA ALDPAEPAVP       300
     LVGMAHEDAV VLARAWLRGL AVARRVPRIE VARAEVEVDV DMESFGDLGA YMWGCLLSGA       360
     DVGVEPGYRA FATWDKLPCA DEARSFAEFW AWLTGVRRAA AERGLGFKAY CYNELAENRW       420
     LLSSAQRFKG QPGVPPVAEV KEFITSDDWV DLFGVVRDQF LSTNGKGLKT IAPLAGFHWR       480
     DPEAGGENSM RWYRDAVGMD GQEPDPAQRR RLLEYNEDDV RATHALRGWM TSDAVAGLPY       540
     AGDL                                                                    544
//

If you have problems or comments...

PBIL Back to PBIL home page