(data stored in ACNUC7421 zone)

EMBL: CP001630.PE460

CP001630.PE460       Location/Qualifiers
FT   CDS             507755..508237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0467"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain
FT                   protein; PFAM: molybdopterin binding domain; KEGG:
FT                   sfu:Sfum_0070 molybdenum cofactor synthesis domain"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34434"
FT                   /db_xref="GOA:C6WHY3"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHY3"
FT                   /inference="protein motif:TFAM:TIGR00177"
FT                   /protein_id="ACU34434.1"
FT                   /translation="MSAPRAARVVTASNRASAGVYADRGGPLIVGWLRERGYDVPDPAV
FT                   VPDGEPVAEALRAAVADGVAVVITTGGTGISPTDRTPEATRSVLDFEVPGLADAIRTSG
FT                   WPAVPGSVLSRGVAGVAGRTLVVNLPGSTGGVKDGLAVLDAVLEHAVEQVGGGDHR"
     MSAPRAARVV TASNRASAGV YADRGGPLIV GWLRERGYDV PDPAVVPDGE PVAEALRAAV        60
     ADGVAVVITT GGTGISPTDR TPEATRSVLD FEVPGLADAI RTSGWPAVPG SVLSRGVAGV       120
     AGRTLVVNLP GSTGGVKDGL AVLDAVLEHA VEQVGGGDHR                             160
//

If you have problems or comments...

PBIL Back to PBIL home page