(data stored in ACNUC7421 zone)

EMBL: CP001630.PE461

CP001630.PE461       Location/Qualifiers
FT   CDS             508234..508659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0468"
FT                   /product="molybdopterin biosynthesis MoaE protein"
FT                   /note="PFAM: molybdopterin biosynthesis MoaE protein; KEGG:
FT                   scl:sce2941 molybdopterin-converting factor chain 2"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34435"
FT                   /db_xref="GOA:C6WHY4"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHY4"
FT                   /inference="protein motif:PFAM:PF02391"
FT                   /protein_id="ACU34435.1"
FT                   /translation="MTEVLRAAVTEDPISVDEHAKLVEHASAGAVVTFSGVVRDHDHGR
FT                   SVRELEYHGHPSAGDVVAEVVSDVAGRFEGVRAVAVSHRVGPLAIGDVALAVAVSAAHR
FT                   GAAFAVCSELVDEVKRRLPVWKRQVFADGSDEWVNCP"
     MTEVLRAAVT EDPISVDEHA KLVEHASAGA VVTFSGVVRD HDHGRSVREL EYHGHPSAGD        60
     VVAEVVSDVA GRFEGVRAVA VSHRVGPLAI GDVALAVAVS AAHRGAAFAV CSELVDEVKR       120
     RLPVWKRQVF ADGSDEWVNC P                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page