(data stored in ACNUC7421 zone)

EMBL: CP001630.PE462

CP001630.PE462       Location/Qualifiers
FT   CDS             complement(509101..509775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0469"
FT                   /product="Transglycosylase domain protein"
FT                   /note="PFAM: Transglycosylase domain protein; SMART:
FT                   Peptidoglycan-binding LysM; KEGG: vei:Veis_4083
FT                   peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34436"
FT                   /db_xref="InterPro:IPR010618"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHY5"
FT                   /inference="protein motif:PFAM:PF06737"
FT                   /protein_id="ACU34436.1"
FT                   /translation="MAVYRGKHRFQSLRANAAVRGIAKVAVAGVIVGAPLAMAGTASAQ
FT                   GSGVNWDAVAACESGGNWSINTGNGYYGGLQFSPSTWSSHGGSGMANQASRAEQIRVAE
FT                   NVMKTQGIGAWPVCGPKGLGGGAAPARTAPAPQQAAPAPQKQSTPQKRATAPVQQQAAP
FT                   VVVALPQSNPNGDYEIKAGDTLSKIASELKVEGGWAKLHELNKQYIPNADLIMSGMKIA
FT                   TK"
     MAVYRGKHRF QSLRANAAVR GIAKVAVAGV IVGAPLAMAG TASAQGSGVN WDAVAACESG        60
     GNWSINTGNG YYGGLQFSPS TWSSHGGSGM ANQASRAEQI RVAENVMKTQ GIGAWPVCGP       120
     KGLGGGAAPA RTAPAPQQAA PAPQKQSTPQ KRATAPVQQQ AAPVVVALPQ SNPNGDYEIK       180
     AGDTLSKIAS ELKVEGGWAK LHELNKQYIP NADLIMSGMK IATK                        224
//

If you have problems or comments...

PBIL Back to PBIL home page