(data stored in ACNUC7421 zone)

EMBL: CP001630.PE463

CP001630.PE463       Location/Qualifiers
FT   CDS             complement(510138..510401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0470"
FT                   /product="thiamineS protein"
FT                   /note="PFAM: thiamineS protein; KEGG: ade:Adeh_1120
FT                   molybdopterin synthase subunit MoaE / molybdopterin
FT                   synthase subunit MoaD"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34437"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHY6"
FT                   /inference="protein motif:PFAM:PF02597"
FT                   /protein_id="ACU34437.1"
FT                   /translation="MVELTVRYFAGARAAAGVPAETVAVPGAGSGTTVAHVLDVVRAKH
FT                   GANLTRVLAASSFLLDGIAVRDHAAAVSAGAELDVLPPFAGG"
     MVELTVRYFA GARAAAGVPA ETVAVPGAGS GTTVAHVLDV VRAKHGANLT RVLAASSFLL        60
     DGIAVRDHAA AVSAGAELDV LPPFAGG                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page