(data stored in ACNUC7421 zone)

EMBL: CP001630.PE464

CP001630.PE464       Location/Qualifiers
FT   CDS             complement(510403..511428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0471"
FT                   /product="molybdenum cofactor biosynthesis protein A"
FT                   /note="KEGG: sus:Acid_6425 GTP cyclohydrolase subunit MoaA;
FT                   TIGRFAM: molybdenum cofactor biosynthesis protein A; PFAM:
FT                   molybdenum cofactor synthesis domain protein; Radical SAM
FT                   domain protein; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34438"
FT                   /db_xref="GOA:C6WHY7"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHY7"
FT                   /inference="protein motif:TFAM:TIGR02666"
FT                   /protein_id="ACU34438.1"
FT                   /translation="MRSAPHVTARPESPSLIDRFGRVATDLRVSLTDKCNLRCTYCMPA
FT                   EGLDWLRGPELLSDEELVRVIGIAVTRLGVTDVRFTGGEPLLRRGLEDVLAATTALEPR
FT                   PRTSMTTNGISLATRAAGLKAAGLDRVNVSLDTLDRERFRELTRRDRLPDVLAGLAAAR
FT                   EAGLEPVKINSVLMRGVNDDEAVALVEFAVEHGYQLRFIEQMPLDPQHGWDRSEMVTAQ
FT                   EILDALGTRFALAPVLARGAAPAERWVVDGGPSVVGVIAAVTRPFCAACDRTRLTADGQ
FT                   VRNCLFSGAETDLRALLRSGASDEEVAERWRGNAWAKAEGHGIDGDGFAQPDRPMSAIG
FT                   G"
     MRSAPHVTAR PESPSLIDRF GRVATDLRVS LTDKCNLRCT YCMPAEGLDW LRGPELLSDE        60
     ELVRVIGIAV TRLGVTDVRF TGGEPLLRRG LEDVLAATTA LEPRPRTSMT TNGISLATRA       120
     AGLKAAGLDR VNVSLDTLDR ERFRELTRRD RLPDVLAGLA AAREAGLEPV KINSVLMRGV       180
     NDDEAVALVE FAVEHGYQLR FIEQMPLDPQ HGWDRSEMVT AQEILDALGT RFALAPVLAR       240
     GAAPAERWVV DGGPSVVGVI AAVTRPFCAA CDRTRLTADG QVRNCLFSGA ETDLRALLRS       300
     GASDEEVAER WRGNAWAKAE GHGIDGDGFA QPDRPMSAIG G                           341
//

If you have problems or comments...

PBIL Back to PBIL home page