(data stored in ACNUC7421 zone)

EMBL: CP001630.PE465

CP001630.PE465       Location/Qualifiers
FT   CDS             511563..512024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0472"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: bja:bll4976 transcriptional regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34439"
FT                   /db_xref="GOA:C6WHY8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHY8"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACU34439.1"
FT                   /translation="MSEHDVPAEELERFSAHARETGALTALLHGRAAERMGLSTTDEKC
FT                   LGLALAGDVPVTAGRMAELSGLSTGAVTGVIDRLERAGYVRRVRDPHDRRKVLVEVSGP
FT                   RAGEVAVLFREAAEVLEAALRRFTPEERAVVERYQLALLEAVRGRVADA"
     MSEHDVPAEE LERFSAHARE TGALTALLHG RAAERMGLST TDEKCLGLAL AGDVPVTAGR        60
     MAELSGLSTG AVTGVIDRLE RAGYVRRVRD PHDRRKVLVE VSGPRAGEVA VLFREAAEVL       120
     EAALRRFTPE ERAVVERYQL ALLEAVRGRV ADA                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page