(data stored in ACNUC7421 zone)

EMBL: CP001630.PE466

CP001630.PE466       Location/Qualifiers
FT   CDS             512044..512832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0473"
FT                   /product="HAD-superfamily hydrolase, subfamily IIA"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IIA;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   csa:Csal_0794 HAD-superfamily hydrolase, subfamily IIA"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34440"
FT                   /db_xref="GOA:C6WHY9"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHY9"
FT                   /inference="protein motif:TFAM:TIGR01460"
FT                   /protein_id="ACU34440.1"
FT                   /translation="MGWNYLMDMDGVLVHEEHPIPGSGEFVAELTAAGIPFLVLTNNSI
FT                   YTPRDLRARLSRTGLEVPETAIWTSALATARFLDSQRPGGSAFVIGEAGLTTALHEVGY
FT                   VLTDRDPDYVVLGETRTYSFTAITKAIRLVEEGAKFIATNPDATGPSREGSLPATGAVA
FT                   ALIERATGREPYYVGKPNSLMMRSALRALGAHSENTLMIGDRMDTDVRAGLEAGLRTIL
FT                   VLSGISADSTAELYPYRPTRVLNSIADLVGHSADPFGELG"
     MGWNYLMDMD GVLVHEEHPI PGSGEFVAEL TAAGIPFLVL TNNSIYTPRD LRARLSRTGL        60
     EVPETAIWTS ALATARFLDS QRPGGSAFVI GEAGLTTALH EVGYVLTDRD PDYVVLGETR       120
     TYSFTAITKA IRLVEEGAKF IATNPDATGP SREGSLPATG AVAALIERAT GREPYYVGKP       180
     NSLMMRSALR ALGAHSENTL MIGDRMDTDV RAGLEAGLRT ILVLSGISAD STAELYPYRP       240
     TRVLNSIADL VGHSADPFGE LG                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page