(data stored in ACNUC7421 zone)

EMBL: CP001630.PE467

CP001630.PE467       Location/Qualifiers
FT   CDS             512991..513695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0474"
FT                   /product="protein of unknown function DUF1503"
FT                   /note="PFAM: protein of unknown function DUF1503; KEGG:
FT                   scl:sce8705 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34441"
FT                   /db_xref="GOA:C6WHZ0"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHZ0"
FT                   /inference="protein motif:PFAM:PF07398"
FT                   /protein_id="ACU34441.1"
FT                   /translation="MAERGDGLEAVVRGRFDAPVPACPGWLVGDLVRHVAEVELWWAAA
FT                   LPAGGAAPDVDGVRREVGELFAGAGPDGPRAVSARVEDGAPVWAWWSPTGRTPAAEVLR
FT                   RVAHELVVHHHDARAAVGEPLAAPPEPAEDGVAEFTERLLGGDLARPGVVGLRAVDTGR
FT                   TRSVGSAGDGLRLLTADEADRVRAGGGAEGALSGTAELLHLALWRRAPLERLEVGGSTG
FT                   LARAALAASRLG"
     MAERGDGLEA VVRGRFDAPV PACPGWLVGD LVRHVAEVEL WWAAALPAGG AAPDVDGVRR        60
     EVGELFAGAG PDGPRAVSAR VEDGAPVWAW WSPTGRTPAA EVLRRVAHEL VVHHHDARAA       120
     VGEPLAAPPE PAEDGVAEFT ERLLGGDLAR PGVVGLRAVD TGRTRSVGSA GDGLRLLTAD       180
     EADRVRAGGG AEGALSGTAE LLHLALWRRA PLERLEVGGS TGLARAALAA SRLG             234
//

If you have problems or comments...

PBIL Back to PBIL home page