(data stored in ACNUC7421 zone)

EMBL: CP001630.PE468

CP001630.PE468       Location/Qualifiers
FT   CDS             514093..514917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0475"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: serine/threonine
FT                   protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34442"
FT                   /db_xref="GOA:C6WHZ1"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHZ1"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACU34442.1"
FT                   /translation="MPAPPRAVAYRRCVERQLYVVGDVHGHLAELTRALNAAGLVDDSG
FT                   DWSGGDAELWFLGDFVDRGPDGIGVIDLVMRLSAQAGESGGRVDSLVGNHEVLLLGMHR
FT                   FGDEDVPGAPTPRSFAKSWNLNGGLRSDQDRLTPEHVEWLTSRDVVHLVDGHLLMHSDT
FT                   LAYLEWGGTVDEVNEAVRAILTGDDLAQWWECWRKMTTRYAFRGPEGGVVAGELLKLMG
FT                   GAEIVHGHSVFADQLGVMPEEVDGPLRYADDRVLAVDAGLYSGGPCLVVELR"
     MPAPPRAVAY RRCVERQLYV VGDVHGHLAE LTRALNAAGL VDDSGDWSGG DAELWFLGDF        60
     VDRGPDGIGV IDLVMRLSAQ AGESGGRVDS LVGNHEVLLL GMHRFGDEDV PGAPTPRSFA       120
     KSWNLNGGLR SDQDRLTPEH VEWLTSRDVV HLVDGHLLMH SDTLAYLEWG GTVDEVNEAV       180
     RAILTGDDLA QWWECWRKMT TRYAFRGPEG GVVAGELLKL MGGAEIVHGH SVFADQLGVM       240
     PEEVDGPLRY ADDRVLAVDA GLYSGGPCLV VELR                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page