(data stored in ACNUC7421 zone)

EMBL: CP001630.PE469

CP001630.PE469       Location/Qualifiers
FT   CDS             complement(514951..515325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0476"
FT                   /product="protein of unknown function DUF307"
FT                   /note="PFAM: protein of unknown function DUF307; KEGG:
FT                   rpa:RPA0774 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34443"
FT                   /db_xref="GOA:C6WHZ2"
FT                   /db_xref="InterPro:IPR005185"
FT                   /db_xref="InterPro:IPR031308"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHZ2"
FT                   /inference="protein motif:PFAM:PF03733"
FT                   /protein_id="ACU34443.1"
FT                   /translation="MRLVLNLIWLVISGFWLAVGYAIAGVICCVFIITIPWGLASFRIA
FT                   NYALWPFGRDVVDRHDAGAASLLGNIIWIVVAGWWLAIGHIVTGLALCVTIIGIPMGIA
FT                   NFKLIPVSLMPLGKVIVDRP"
     MRLVLNLIWL VISGFWLAVG YAIAGVICCV FIITIPWGLA SFRIANYALW PFGRDVVDRH        60
     DAGAASLLGN IIWIVVAGWW LAIGHIVTGL ALCVTIIGIP MGIANFKLIP VSLMPLGKVI       120
     VDRP                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page