(data stored in ACNUC7421 zone)

EMBL: CP001630.PE47

CP001630.PE47        Location/Qualifiers
FT   CDS             complement(51262..52014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0047"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; NAD-dependent epimerase/dehydratase; KEGG:
FT                   bac:BamMC406_2467 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34021"
FT                   /db_xref="GOA:C6WCK0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCK0"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACU34021.1"
FT                   /translation="MEISGTAAIVTGGASGLGAATARALAARGARVFALDISVDGAPAV
FT                   EGVTYLAADVTSEEDVQAAVDTAAGSGAPLRIAVNCAGIGPSTRTVGKAGPHPLDLYRK
FT                   VLDVNVVGTFNVLRLAAAAMGATEPGPDGARGVVVNTASVAAYEGQIGQVAYASSKAAV
FT                   VGMTLPAARDLSSVGVRVMTIAPGIVDTPMLATVSEEFRAGLAAGVPFPKRLALPDEYA
FT                   RLALSIIEHDYLNGEVVRMDGALRMAPR"
     MEISGTAAIV TGGASGLGAA TARALAARGA RVFALDISVD GAPAVEGVTY LAADVTSEED        60
     VQAAVDTAAG SGAPLRIAVN CAGIGPSTRT VGKAGPHPLD LYRKVLDVNV VGTFNVLRLA       120
     AAAMGATEPG PDGARGVVVN TASVAAYEGQ IGQVAYASSK AAVVGMTLPA ARDLSSVGVR       180
     VMTIAPGIVD TPMLATVSEE FRAGLAAGVP FPKRLALPDE YARLALSIIE HDYLNGEVVR       240
     MDGALRMAPR                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page