(data stored in ACNUC7421 zone)

EMBL: CP001630.PE470

CP001630.PE470       Location/Qualifiers
FT   CDS             515358..516356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0477"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; homoserine
FT                   dehydrogenase NAD-binding; Oxidoreductase domain; KEGG:
FT                   similar to dimeric dihydrodiol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34444"
FT                   /db_xref="GOA:C6WHZ3"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHZ3"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACU34444.1"
FT                   /translation="MLRTVRWGIVATGGIADVVTADLLALEGSEALAVSSRKLERAREF
FT                   ATKHGIPRAYGSVEELVADPDVDVVYVATPHAQHRSAARLALEAGKHVLCEKPMTLTVE
FT                   DTRELVELARERGLFLMEAIWTRFNPLIRQVRAAVADGEIGDVRSVRADFGFALPFEPG
FT                   HRLWNPELGGGSLMDLGLYPVSIAQMLLGDPTTIQVTGSLAPSGVDAEAALLLGYESGA
FT                   HALLTSTLTTSPGSYATVFGTEGRIDLHQPAHCPTRVVINDVERTAELEGSGYVPQLRE
FT                   VADRVRAGDTESPDMSWADSLSIARVLAEGVARLGVRYPQPDRDVTPPTAG"
     MLRTVRWGIV ATGGIADVVT ADLLALEGSE ALAVSSRKLE RAREFATKHG IPRAYGSVEE        60
     LVADPDVDVV YVATPHAQHR SAARLALEAG KHVLCEKPMT LTVEDTRELV ELARERGLFL       120
     MEAIWTRFNP LIRQVRAAVA DGEIGDVRSV RADFGFALPF EPGHRLWNPE LGGGSLMDLG       180
     LYPVSIAQML LGDPTTIQVT GSLAPSGVDA EAALLLGYES GAHALLTSTL TTSPGSYATV       240
     FGTEGRIDLH QPAHCPTRVV INDVERTAEL EGSGYVPQLR EVADRVRAGD TESPDMSWAD       300
     SLSIARVLAE GVARLGVRYP QPDRDVTPPT AG                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page