(data stored in ACNUC7421 zone)

EMBL: CP001630.PE471

CP001630.PE471       Location/Qualifiers
FT   CDS             complement(516334..517299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0478"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bbt:BBta_0237
FT                   OmpA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34445"
FT                   /db_xref="GOA:C6WHZ4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR040611"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHZ4"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU34445.1"
FT                   /translation="MITCLYKGPALVPKLSVVTEFTGTARPEATPAAALRPPAAPPVPR
FT                   RAPCGEPTVPLARADARPLAPDTGPRPPESPAAHAHQPESHAAHPHQGLAAPPDAAAPP
FT                   DAAAPRPARREPATAPIPAAPTEPPGPIIDAAVALVAEHGARGLRVADVASRAGVSRQT
FT                   VYNEHGNKQRLVEAVALVKTTEFVDAARACLARAPGAVEGVAEAVRQVHALTRLDPLAR
FT                   SVLTGTDADDMLPMLTTRGGWVLDLVVPAIGEHLARHRPDLPPARVAFAADVLTRLALS
FT                   HLLTPDHGADGEVDRAVDLAVEAVTGVAVALLGPSPRWAG"
     MITCLYKGPA LVPKLSVVTE FTGTARPEAT PAAALRPPAA PPVPRRAPCG EPTVPLARAD        60
     ARPLAPDTGP RPPESPAAHA HQPESHAAHP HQGLAAPPDA AAPPDAAAPR PARREPATAP       120
     IPAAPTEPPG PIIDAAVALV AEHGARGLRV ADVASRAGVS RQTVYNEHGN KQRLVEAVAL       180
     VKTTEFVDAA RACLARAPGA VEGVAEAVRQ VHALTRLDPL ARSVLTGTDA DDMLPMLTTR       240
     GGWVLDLVVP AIGEHLARHR PDLPPARVAF AADVLTRLAL SHLLTPDHGA DGEVDRAVDL       300
     AVEAVTGVAV ALLGPSPRWA G                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page