(data stored in ACNUC7421 zone)

EMBL: CP001630.PE472

CP001630.PE472       Location/Qualifiers
FT   CDS             517475..518131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0479"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: afw:Anae109_2037 HAD family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34446"
FT                   /db_xref="GOA:C6WHZ5"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHZ5"
FT                   /inference="protein motif:PFAM:PF00702"
FT                   /protein_id="ACU34446.1"
FT                   /translation="MPLTIGFDLDMTLIDPRPGMAAVMEAVRAESGYPIDGAHFAANLG
FT                   PPLDVSFRGYGVPEEDVPVLVARFRALYPEIVIPATVALPGAAESLDAVRELGGTTVVV
FT                   TGKYRANAALHLAAFDWEVDHLFGELWSTGKAEALKLHGASAYVGDHVGDVRGAKAAGA
FT                   LSVCVVTGPCDERELVEAGADVVMPDLTGFPAWLRENADRLRATGRAALEAERPA"
     MPLTIGFDLD MTLIDPRPGM AAVMEAVRAE SGYPIDGAHF AANLGPPLDV SFRGYGVPEE        60
     DVPVLVARFR ALYPEIVIPA TVALPGAAES LDAVRELGGT TVVVTGKYRA NAALHLAAFD       120
     WEVDHLFGEL WSTGKAEALK LHGASAYVGD HVGDVRGAKA AGALSVCVVT GPCDERELVE       180
     AGADVVMPDL TGFPAWLREN ADRLRATGRA ALEAERPA                               218
//

If you have problems or comments...

PBIL Back to PBIL home page