(data stored in ACNUC7421 zone)

EMBL: CP001630.PE474

CP001630.PE474       Location/Qualifiers
FT   CDS             518534..518929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0481"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: bcy:Bcer98_3497 cold-shock DNA-binding
FT                   domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34448"
FT                   /db_xref="GOA:C6WHZ7"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHZ7"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ACU34448.1"
FT                   /translation="MRAVPTGKVKWYDSEKGFGFVTQDGGEDVYVRKSALPEGVDALKA
FT                   GQRIEFGMAEGRRGPQALSVRLVDPAPSVAEARRRPADELNVVIEDLIRLLEQRVQPEL
FT                   RRSRYPERKSAKLVADALRAIARDLDP"
     MRAVPTGKVK WYDSEKGFGF VTQDGGEDVY VRKSALPEGV DALKAGQRIE FGMAEGRRGP        60
     QALSVRLVDP APSVAEARRR PADELNVVIE DLIRLLEQRV QPELRRSRYP ERKSAKLVAD       120
     ALRAIARDLD P                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page