(data stored in ACNUC7421 zone)

EMBL: CP001630.PE475

CP001630.PE475       Location/Qualifiers
FT   CDS             complement(519009..519494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0482"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34449"
FT                   /db_xref="InterPro:IPR024495"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHZ8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34449.1"
FT                   /translation="MRRAVVLTALPLLLATGCGAPPHPEVTFYADGRTVVVAPTQYCDL
FT                   DSENCDVDPSAAGVLRVRPGKPVQISVPAQLADSVWAVAFTYRDAAGVTQEPMRSKVFT
FT                   PNNPQHAYTLQLPNDTDQLESVEVQQLGTRIEGSTTAAVDFVARGTWVLSVDDRQRG"
     MRRAVVLTAL PLLLATGCGA PPHPEVTFYA DGRTVVVAPT QYCDLDSENC DVDPSAAGVL        60
     RVRPGKPVQI SVPAQLADSV WAVAFTYRDA AGVTQEPMRS KVFTPNNPQH AYTLQLPNDT       120
     DQLESVEVQQ LGTRIEGSTT AAVDFVARGT WVLSVDDRQR G                           161
//

If you have problems or comments...

PBIL Back to PBIL home page