(data stored in ACNUC7421 zone)

EMBL: CP001630.PE476

CP001630.PE476       Location/Qualifiers
FT   CDS             complement(519518..521248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0483"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mrd:Mrad2831_4876 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34450"
FT                   /db_xref="GOA:C6WHZ9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHZ9"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU34450.1"
FT                   /translation="MSPSDDRDHPRGDHPREDETRPERGGAGRERSDSAPWETYDPDGY
FT                   DRLSRERGRGRAERDHYDREAYDERGRERGGADRDTVPTGQAGPRRTKPIPGRDERTRP
FT                   THKPTQLPRKLTVTRVALYRARLLSSVGLGRLRTAAHADGAGESGLSSLTYAVMLGLAA
FT                   DAALAVALANALFFSAGVDESRTRAGLYLLVAAVPFALLAPLLGPALDHLRRGRRWALA
FT                   GSCALRVAAAVVLALHFDGWALYPAALVSVLLSRSFTALREAITPEVLPPEVERARADA
FT                   RLTAFGLVAGVVSGLAAIGLVNTFGPPGALWLSAALCVANTWCCLRVPARAEVAEGGTP
FT                   GARGQGAAGRDAKGPDAKGPDAKGQDAKGRERGRRALGRAVVAALWANGSIRVLAGFLV
FT                   LFAAFLVRAEVEYDPVQQLLLLGVVVAAAVAGGLLGGVVGARLPAGSPDRVLIGCVGAA
FT                   LASALLAAALPGLTTVAVVGLVGAAAGTLAKATLDAVARDELPERSPALVRPEALLRLG
FT                   WVFGGALGVLLPTEQWIGFAVVSLLLALGLAQVVLTWRGRSLLPRIGGDRQAGAGAADG
FT                   "
     MSPSDDRDHP RGDHPREDET RPERGGAGRE RSDSAPWETY DPDGYDRLSR ERGRGRAERD        60
     HYDREAYDER GRERGGADRD TVPTGQAGPR RTKPIPGRDE RTRPTHKPTQ LPRKLTVTRV       120
     ALYRARLLSS VGLGRLRTAA HADGAGESGL SSLTYAVMLG LAADAALAVA LANALFFSAG       180
     VDESRTRAGL YLLVAAVPFA LLAPLLGPAL DHLRRGRRWA LAGSCALRVA AAVVLALHFD       240
     GWALYPAALV SVLLSRSFTA LREAITPEVL PPEVERARAD ARLTAFGLVA GVVSGLAAIG       300
     LVNTFGPPGA LWLSAALCVA NTWCCLRVPA RAEVAEGGTP GARGQGAAGR DAKGPDAKGP       360
     DAKGQDAKGR ERGRRALGRA VVAALWANGS IRVLAGFLVL FAAFLVRAEV EYDPVQQLLL       420
     LGVVVAAAVA GGLLGGVVGA RLPAGSPDRV LIGCVGAALA SALLAAALPG LTTVAVVGLV       480
     GAAAGTLAKA TLDAVARDEL PERSPALVRP EALLRLGWVF GGALGVLLPT EQWIGFAVVS       540
     LLLALGLAQV VLTWRGRSLL PRIGGDRQAG AGAADG                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page