(data stored in ACNUC7421 zone)

EMBL: CP001630.PE477

CP001630.PE477       Location/Qualifiers
FT   CDS             complement(521305..522084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0484"
FT                   /product="glutamine cyclotransferase"
FT                   /note="PFAM: glutamine cyclotransferase; KEGG:
FT                   sus:Acid_3566 glutamine cyclotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34451"
FT                   /db_xref="GOA:C6WI00"
FT                   /db_xref="InterPro:IPR007788"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI00"
FT                   /inference="protein motif:PFAM:PF05096"
FT                   /protein_id="ACU34451.1"
FT                   /translation="MVPVVVVAVLSGCSSGGDGVRSTEPAGPSTPATARPEVLGTIPHD
FT                   PAAFTQGLEVSGDALYEGTGLEGRSSIREVDPATGEVRRKLDLPSPLFGEGITVVGERI
FT                   WQLTWRDGVAIERDRASLAEVRRVPYEGEGWGLCLDGDRLVMSDGTADLTFRDPATFEE
FT                   RGRVAVTRAGEPLEDLNELECVDGRVWANVWQTDEVVRIDPVTGAVDLVADLSSLRPEG
FT                   VPASDVLNGIASVPGSDEFLVTGKNWPSMFRVRLPPG"
     MVPVVVVAVL SGCSSGGDGV RSTEPAGPST PATARPEVLG TIPHDPAAFT QGLEVSGDAL        60
     YEGTGLEGRS SIREVDPATG EVRRKLDLPS PLFGEGITVV GERIWQLTWR DGVAIERDRA       120
     SLAEVRRVPY EGEGWGLCLD GDRLVMSDGT ADLTFRDPAT FEERGRVAVT RAGEPLEDLN       180
     ELECVDGRVW ANVWQTDEVV RIDPVTGAVD LVADLSSLRP EGVPASDVLN GIASVPGSDE       240
     FLVTGKNWPS MFRVRLPPG                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page