(data stored in ACNUC7421 zone)

EMBL: CP001630.PE478

CP001630.PE478       Location/Qualifiers
FT   CDS             522145..523071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0485"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GL17023 gene product from transcript GL17023-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34452"
FT                   /db_xref="InterPro:IPR021391"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI01"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34452.1"
FT                   /translation="MRHNPPVTATPTQQPQPVLADPAAVRLARDAAQEEAGSEHVGAHV
FT                   GVLVEDETSVTHFFEADHAGYRGWRWAVTLATAGEGSPVSVSEAVLLPGNDALVAPQWV
FT                   PWNERVRAGDLGVGDLLPASPDDPRLAPGYVGSEDPAVEEVALEVGLGRVRVLSREGVL
FT                   DAAERWRGGDFGPRSEMARSAPAACGTCGFYLRVAGALGAAFGVCGNELTPADGHVVHV
FT                   EYGCGAHSEVEVEGGSAVPVADVVYDDALLEVEVNEPVGRSDNDTADAAAGGATAGEGD
FT                   TPGAVDEVERVSDGSGATGVSGRATSR"
     MRHNPPVTAT PTQQPQPVLA DPAAVRLARD AAQEEAGSEH VGAHVGVLVE DETSVTHFFE        60
     ADHAGYRGWR WAVTLATAGE GSPVSVSEAV LLPGNDALVA PQWVPWNERV RAGDLGVGDL       120
     LPASPDDPRL APGYVGSEDP AVEEVALEVG LGRVRVLSRE GVLDAAERWR GGDFGPRSEM       180
     ARSAPAACGT CGFYLRVAGA LGAAFGVCGN ELTPADGHVV HVEYGCGAHS EVEVEGGSAV       240
     PVADVVYDDA LLEVEVNEPV GRSDNDTADA AAGGATAGEG DTPGAVDEVE RVSDGSGATG       300
     VSGRATSR                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page