(data stored in ACNUC7421 zone)

EMBL: CP001630.PE479

CP001630.PE479       Location/Qualifiers
FT   CDS             523068..525896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0486"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nha:Nham_3709 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34453"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI02"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34453.1"
FT                   /translation="MSADHFGTEALRESVLAAWRGSPTRFREDANAEEDLRLGGYRDRL
FT                   LVELAQNAADAAGAEPGVLRLSFVDGEFRAANTGAPLTADGVTALASLRASAKSSDAVG
FT                   QFGVGFAAVLAVTDAPRVVSTSGGVAFSAARTREAVPELASKRGGDVPVLRLVWPTDEA
FT                   GPPEGFATEVRLPLTAVDGDALLRECAEQAPDLLLALPGLRRVEVGSRAWDRAEDGDKV
FT                   VITGPDGERAWLVHRVGGELPERFVQGVESRPVWSACWAYPVDGALDGEVLHAPTPTDE
FT                   KLSLPARLIATLPVEPSRRRVLVGPAAEHVLAMAARAYPALVAALPAVERTALVPLPGF
FT                   PLSEVDGVLRQGVLAALRDAEWLPKADGGWTSPRRAKVLDSPSEDLVDLLEDVVPGLLD
FT                   AELVLPEHARALAALDVPRMPVAEVVAALAGIGGEPGWWHDVYTALQPWADVDSSAREE
FT                   LGALPVPLADGRLVSGPRGVLMLDEPIDFERTGLRVAHPEAVHPLLLRLGAVEAGAAEV
FT                   LDSDAVRDAVRHSGDDPDEDLVHGVLSLVARAGGRPWLGELVLPEAGGGWRRADELLLP
FT                   DAPLREVLADDAPFGVLDAEFAADWPRDVLSAVGAADGFTVLVDDEPTGPDHDLADEAD
FT                   WWDAADEPPSRVVGVRDLDLVAEGKWTRALELMASDPEVWRAVARRDGYAGWWLARYAR
FT                   IDGRAPRAWRLPGAVELEGLYDPVGSELPAHVLAAAGVRTELVVHDEDDVVDLLARLGD
FT                   AERVVPDALVLKAHAALAEVAPDVREGAVEPPDHVRVLTGAVVSADDVVVPDLPWLLAV
FT                   LPGEQVLAADGGAAELAELLELPLASEEVVGSLRSEGDEVVWAELGAVRVACALLGVEL
FT                   PRGTVVVHDELVVHAEGEEHEVPWWVDGEVVHAADTPEGLARALAWTTGRWADRHTFAA
FT                   LITEPTPAVLLG"
     MSADHFGTEA LRESVLAAWR GSPTRFREDA NAEEDLRLGG YRDRLLVELA QNAADAAGAE        60
     PGVLRLSFVD GEFRAANTGA PLTADGVTAL ASLRASAKSS DAVGQFGVGF AAVLAVTDAP       120
     RVVSTSGGVA FSAARTREAV PELASKRGGD VPVLRLVWPT DEAGPPEGFA TEVRLPLTAV       180
     DGDALLRECA EQAPDLLLAL PGLRRVEVGS RAWDRAEDGD KVVITGPDGE RAWLVHRVGG       240
     ELPERFVQGV ESRPVWSACW AYPVDGALDG EVLHAPTPTD EKLSLPARLI ATLPVEPSRR       300
     RVLVGPAAEH VLAMAARAYP ALVAALPAVE RTALVPLPGF PLSEVDGVLR QGVLAALRDA       360
     EWLPKADGGW TSPRRAKVLD SPSEDLVDLL EDVVPGLLDA ELVLPEHARA LAALDVPRMP       420
     VAEVVAALAG IGGEPGWWHD VYTALQPWAD VDSSAREELG ALPVPLADGR LVSGPRGVLM       480
     LDEPIDFERT GLRVAHPEAV HPLLLRLGAV EAGAAEVLDS DAVRDAVRHS GDDPDEDLVH       540
     GVLSLVARAG GRPWLGELVL PEAGGGWRRA DELLLPDAPL REVLADDAPF GVLDAEFAAD       600
     WPRDVLSAVG AADGFTVLVD DEPTGPDHDL ADEADWWDAA DEPPSRVVGV RDLDLVAEGK       660
     WTRALELMAS DPEVWRAVAR RDGYAGWWLA RYARIDGRAP RAWRLPGAVE LEGLYDPVGS       720
     ELPAHVLAAA GVRTELVVHD EDDVVDLLAR LGDAERVVPD ALVLKAHAAL AEVAPDVREG       780
     AVEPPDHVRV LTGAVVSADD VVVPDLPWLL AVLPGEQVLA ADGGAAELAE LLELPLASEE       840
     VVGSLRSEGD EVVWAELGAV RVACALLGVE LPRGTVVVHD ELVVHAEGEE HEVPWWVDGE       900
     VVHAADTPEG LARALAWTTG RWADRHTFAA LITEPTPAVL LG                          942
//

If you have problems or comments...

PBIL Back to PBIL home page