(data stored in ACNUC7421 zone)

EMBL: CP001630.PE48

CP001630.PE48        Location/Qualifiers
FT   CDS             complement(52050..52175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34022"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCK1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34022.1"
FT                   /translation="MHRFPMQVLMFALVFAGLALVAAVPLVALLHVSEHHGLNDR"
     MHRFPMQVLM FALVFAGLAL VAAVPLVALL HVSEHHGLND R                            41
//

If you have problems or comments...

PBIL Back to PBIL home page