(data stored in ACNUC7421 zone)

EMBL: CP001630.PE481

CP001630.PE481       Location/Qualifiers
FT   CDS             526391..527830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0488"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; sulphate
FT                   transporter; KEGG: acp:A2cp1_3490 xanthine/uracil/vitamin C
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34455"
FT                   /db_xref="GOA:C6WI04"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI04"
FT                   /inference="protein motif:PFAM:PF00860"
FT                   /protein_id="ACU34455.1"
FT                   /translation="MGLDGFFKITERGSSVGREVRGGVVTFVAMAYIVVLNPLILGSFS
FT                   ADDPSAKTDITGAILPVPQVAAVTALVAGVMTILFGLIANYPFALAAGLGINSFVAVTL
FT                   APQMTWPEAMGLVVVNGVVVLLLVLTGVRTAVFNAVPNELKAAIAVGIGLFICFIGLVD
FT                   AGFVRRIPDAAGTTVPVGLGIGGSIASWPTLVFVVGLLVTGILVARKVRGAILIGVLST
FT                   AVFSIVLEALVKAGPSAGTNPKGWNLGYPAVPDSFFSLPDLSLVGEFSFGAWTRLPALA
FT                   AALLVFTLVLTDFFDTVGTMTGLGKEGELIKEDGQLPNVSKALLVDGVGAVAGGAASAS
FT                   SNTVFIESASGIAEGARTGLANVVTGLLFLVAMFFTPLYEVIPVEAAAPALVIVGALMV
FT                   AQVKEIDFSDFSIALPAFLTIVVMPFTYSIANGIGAGFISYVLLRALTGRARSVHPLMW
FT                   GTAVAFVVYFGIGPIQALIMN"
     MGLDGFFKIT ERGSSVGREV RGGVVTFVAM AYIVVLNPLI LGSFSADDPS AKTDITGAIL        60
     PVPQVAAVTA LVAGVMTILF GLIANYPFAL AAGLGINSFV AVTLAPQMTW PEAMGLVVVN       120
     GVVVLLLVLT GVRTAVFNAV PNELKAAIAV GIGLFICFIG LVDAGFVRRI PDAAGTTVPV       180
     GLGIGGSIAS WPTLVFVVGL LVTGILVARK VRGAILIGVL STAVFSIVLE ALVKAGPSAG       240
     TNPKGWNLGY PAVPDSFFSL PDLSLVGEFS FGAWTRLPAL AAALLVFTLV LTDFFDTVGT       300
     MTGLGKEGEL IKEDGQLPNV SKALLVDGVG AVAGGAASAS SNTVFIESAS GIAEGARTGL       360
     ANVVTGLLFL VAMFFTPLYE VIPVEAAAPA LVIVGALMVA QVKEIDFSDF SIALPAFLTI       420
     VVMPFTYSIA NGIGAGFISY VLLRALTGRA RSVHPLMWGT AVAFVVYFGI GPIQALIMN        479
//

If you have problems or comments...

PBIL Back to PBIL home page