(data stored in ACNUC7421 zone)

EMBL: CP001630.PE483

CP001630.PE483       Location/Qualifiers
FT   CDS             528446..529831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0490"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; protein
FT                   of unknown function DUF894 DitE; KEGG: bpy:Bphyt_5813 major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34457"
FT                   /db_xref="GOA:C6WI06"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI06"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU34457.1"
FT                   /translation="MPAYAEGSQTDRPDRDTALPPPKRKRPGTFSSLKVRNYRLYASGQ
FT                   VVSLVGLWMQRVAQDWLVLELSGGDPVALGLAAALQFAPTLLLSLWAGVLADRLDKRRL
FT                   LLVLETGLGLCALALGLLEVLGAAELWHVYLLCLLLGAVSAVETPVRQSFVVEMVGRDQ
FT                   LTNAVALNSMTFNLARMVGPAVAGGLIVVVGGTGWVFLINAASFVAVIAGLLLMRPAEL
FT                   HRGEPVPREPGQLREGLRYVRKRPDLVILLFLVFFVSTFGLNFYVTLAVLARNTFGGDA
FT                   DAYGLLSTLLAVGTLAGATLAARRSTRGAKPRPVLLVVGALAFGVLEIVAGLMPTLWLV
FT                   GLVLIPVGVAMMTFTTTANATVQLSVTPAMRGRVMGLYMLVFLGGNPVGGPVMGWLADH
FT                   FTARAPLVVGGAVSIVAALVGALVLARRGGMPLPVVRLSRRRAGPDQAVPAAATPAAAT
FT                   PDA"
     MPAYAEGSQT DRPDRDTALP PPKRKRPGTF SSLKVRNYRL YASGQVVSLV GLWMQRVAQD        60
     WLVLELSGGD PVALGLAAAL QFAPTLLLSL WAGVLADRLD KRRLLLVLET GLGLCALALG       120
     LLEVLGAAEL WHVYLLCLLL GAVSAVETPV RQSFVVEMVG RDQLTNAVAL NSMTFNLARM       180
     VGPAVAGGLI VVVGGTGWVF LINAASFVAV IAGLLLMRPA ELHRGEPVPR EPGQLREGLR       240
     YVRKRPDLVI LLFLVFFVST FGLNFYVTLA VLARNTFGGD ADAYGLLSTL LAVGTLAGAT       300
     LAARRSTRGA KPRPVLLVVG ALAFGVLEIV AGLMPTLWLV GLVLIPVGVA MMTFTTTANA       360
     TVQLSVTPAM RGRVMGLYML VFLGGNPVGG PVMGWLADHF TARAPLVVGG AVSIVAALVG       420
     ALVLARRGGM PLPVVRLSRR RAGPDQAVPA AATPAAATPD A                           461
//

If you have problems or comments...

PBIL Back to PBIL home page