(data stored in ACNUC7421 zone)

EMBL: CP001630.PE484

CP001630.PE484       Location/Qualifiers
FT   CDS             529828..531102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0491"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; protein
FT                   of unknown function DUF894 DitE; KEGG: gdi:GDI0684 major
FT                   facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34458"
FT                   /db_xref="GOA:C6WI07"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI07"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU34458.1"
FT                   /translation="MTATGAPPAPRRAGAFSSLRLRNYRLYASGQLVSLVGLWMERVAQ
FT                   DWLVLQLSGGDPIALGVATALQFGPVLALSMWAGVLADRLDKRLLLIGLQSGMAVLALV
FT                   LGLVDLSGVAQLWHVYLLCLAGGVLSAVEAPVRQSFAVEMVGREQVANAVALNSMTFNA
FT                   ARMIGPAVAGGLIVVVGTGWIFLIRAASFAGVLAGLALMRAAELHRGAPVAKARGQLAE
FT                   GLRYLRGRPDLVAVMLVVFLVGVFGLNFHVSLALLASDTFGGDADAYGLLTTTMAVGTL
FT                   AGAAMAARRSAPGPRLLVGGAAAFGVLELLSGLMPTMLTAALALIPVGAAMMTFTTTAN
FT                   STVQLAVAPGMRGRVMGVYMTVFMGSAPLSGLLTGWVADRFDARAPLVLGGAVSVLAAL
FT                   LGALVLARANRMGDTSSQNSEVRLT"
     MTATGAPPAP RRAGAFSSLR LRNYRLYASG QLVSLVGLWM ERVAQDWLVL QLSGGDPIAL        60
     GVATALQFGP VLALSMWAGV LADRLDKRLL LIGLQSGMAV LALVLGLVDL SGVAQLWHVY       120
     LLCLAGGVLS AVEAPVRQSF AVEMVGREQV ANAVALNSMT FNAARMIGPA VAGGLIVVVG       180
     TGWIFLIRAA SFAGVLAGLA LMRAAELHRG APVAKARGQL AEGLRYLRGR PDLVAVMLVV       240
     FLVGVFGLNF HVSLALLASD TFGGDADAYG LLTTTMAVGT LAGAAMAARR SAPGPRLLVG       300
     GAAAFGVLEL LSGLMPTMLT AALALIPVGA AMMTFTTTAN STVQLAVAPG MRGRVMGVYM       360
     TVFMGSAPLS GLLTGWVADR FDARAPLVLG GAVSVLAALL GALVLARANR MGDTSSQNSE       420
     VRLT                                                                    424
//

If you have problems or comments...

PBIL Back to PBIL home page