(data stored in ACNUC7421 zone)

EMBL: CP001630.PE485

CP001630.PE485       Location/Qualifiers
FT   CDS             complement(531287..531916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0492"
FT                   /product="Superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /note="PFAM: manganese and iron superoxide dismutase; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34459"
FT                   /db_xref="GOA:C6WI08"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI08"
FT                   /inference="protein motif:PRIAM:1.15.1.1"
FT                   /protein_id="ACU34459.1"
FT                   /translation="MAQYVLPDLDYDYGDLQPAIIGEINELHHSKHHAAYVKGANDTLE
FT                   QIDEARDKSAFGSIVGLETTLAFHLAGHALHQVWWKNLSPNGGDKPSGELAAAIDEHFG
FT                   SFDGLRAQLNAAAGSIQGSGWGILAWEPVGQRLITQQLKDHHSNLSIATTPLLVFDIWE
FT                   HAYYLQYRNLKADYIGALWNIVNWDDVNARFEAARAGQNGLLLPTR"
     MAQYVLPDLD YDYGDLQPAI IGEINELHHS KHHAAYVKGA NDTLEQIDEA RDKSAFGSIV        60
     GLETTLAFHL AGHALHQVWW KNLSPNGGDK PSGELAAAID EHFGSFDGLR AQLNAAAGSI       120
     QGSGWGILAW EPVGQRLITQ QLKDHHSNLS IATTPLLVFD IWEHAYYLQY RNLKADYIGA       180
     LWNIVNWDDV NARFEAARAG QNGLLLPTR                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page