(data stored in ACNUC7421 zone)

EMBL: CP001630.PE486

CP001630.PE486       Location/Qualifiers
FT   CDS             532020..533633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0493"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: scl:sce6528 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34460"
FT                   /db_xref="GOA:C6WI09"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI09"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACU34460.1"
FT                   /translation="MSALAARNLSLSFGPRTVLSEVDLDVPAGERVGLVAPNGVGKSTL
FT                   LKVLAGELTPERGTVTASGPVAHLTQETAVEPGESLRDHLARRTGVADAEAAFERAAQA
FT                   LAEGAPGAEDAYATAFDRWTAVGAGDFAERADEVCQRLGLPADLLDARGSGELSGGQSA
FT                   RLRLASVLLVRADVLLLDEPTNDLDADGLELLEAHVLGTRAAVVLVSHDREFLSRTITA
FT                   VAELDEFTHGLTAFGGGWDAYLAERDAAARRAQEDYDEYAAKKDALTRRARTAKEWSRA
FT                   GVRRNAKSDERDKFIKFFAKQGAENTAGKGAAADRALERLEEVEEPRKPWELRLTLPAA
FT                   SGGSRVAFTLRGAVVSRGDVTLGPVDLTIGAGERWRLTGPNGSGKSTLLGAILGRVPLD
FT                   AGERSEGSVVVGEIDQVRGAFSGATPVLDVVVAATGLAEAEARTLLAKFRVGADVVLRP
FT                   AGTLSPGERTRAALALLQARGTTCLVLDEPTNHLDLAAIEQLEQALAEYAGTVLLITHD
FT                   RRLATSVGVDHALDVRSLAR"
     MSALAARNLS LSFGPRTVLS EVDLDVPAGE RVGLVAPNGV GKSTLLKVLA GELTPERGTV        60
     TASGPVAHLT QETAVEPGES LRDHLARRTG VADAEAAFER AAQALAEGAP GAEDAYATAF       120
     DRWTAVGAGD FAERADEVCQ RLGLPADLLD ARGSGELSGG QSARLRLASV LLVRADVLLL       180
     DEPTNDLDAD GLELLEAHVL GTRAAVVLVS HDREFLSRTI TAVAELDEFT HGLTAFGGGW       240
     DAYLAERDAA ARRAQEDYDE YAAKKDALTR RARTAKEWSR AGVRRNAKSD ERDKFIKFFA       300
     KQGAENTAGK GAAADRALER LEEVEEPRKP WELRLTLPAA SGGSRVAFTL RGAVVSRGDV       360
     TLGPVDLTIG AGERWRLTGP NGSGKSTLLG AILGRVPLDA GERSEGSVVV GEIDQVRGAF       420
     SGATPVLDVV VAATGLAEAE ARTLLAKFRV GADVVLRPAG TLSPGERTRA ALALLQARGT       480
     TCLVLDEPTN HLDLAAIEQL EQALAEYAGT VLLITHDRRL ATSVGVDHAL DVRSLAR          537
//

If you have problems or comments...

PBIL Back to PBIL home page