(data stored in ACNUC7421 zone)

EMBL: CP001630.PE487

CP001630.PE487       Location/Qualifiers
FT   CDS             533638..534048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0494"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34461"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI10"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34461.1"
FT                   /translation="MGTEEDWPVEQTWSMRNTHWHAYVEHTSLDSASPRAERLERAPEE
FT                   VLTTPTEVAAWLEVNLRSATKPEETGKKRAKDERDFSDSHRVHVSLASRGESIYTGVKG
FT                   MLTLAVEAVTPDDCRSSHDGADVAPLKAGRRR"
     MGTEEDWPVE QTWSMRNTHW HAYVEHTSLD SASPRAERLE RAPEEVLTTP TEVAAWLEVN        60
     LRSATKPEET GKKRAKDERD FSDSHRVHVS LASRGESIYT GVKGMLTLAV EAVTPDDCRS       120
     SHDGADVAPL KAGRRR                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page