(data stored in ACNUC7421 zone)

EMBL: CP001630.PE488

CP001630.PE488       Location/Qualifiers
FT   CDS             complement(534080..535573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0495"
FT                   /product="glutamate--cysteine ligase GCS2"
FT                   /note="PFAM: glutamate--cysteine ligase GCS2; KEGG:
FT                   scl:sce0051 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34462"
FT                   /db_xref="GOA:C6WI11"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR016602"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI11"
FT                   /inference="protein motif:PFAM:PF04107"
FT                   /protein_id="ACU34462.1"
FT                   /translation="MGRDVSTRTFTGEDRRHYRERVQRCLDALGTMLAEDCFSFPRQQM
FT                   GLEIELNLADRAGLPAMRNAEVLEKIDDPAFTLELGQHNLELNVPPRELAGDHTLGLER
FT                   DLRALLGVADAKAQDAGASLVMIGVLPTLRPEHFDRRWLSHNPRYSLLNDQIFAARGEE
FT                   LVLSLEGAPLPGRDAERLLSRSESILPEAACTSVQLHLQVAPEDFAAHWNAAQCLAGVQ
FT                   VAIAANSPFLLGRALWHETRIPLFQQATDTRPQELQNQGVRPRVWFGERWITSIFDLFE
FT                   ENVRYFPALLPETGDEDPVDVLGSGGTPRMTELRLHNGTVWRWNRPVYDVVAGVPHLRI
FT                   ENRVLPAGPTVLDTLANAAFFYGAQRALSSMDRPLWTQMSFQAAEENLYAGARHGMNAQ
FT                   LYWPGIGWVPPDELVLRRLLPLAHEGLRDCGVSDEARERYLGVIEARCLAGRTGALWQR
FT                   EVVAGLEERGAGREGALAGMLARYVERMHEGEPVHTWSV"
     MGRDVSTRTF TGEDRRHYRE RVQRCLDALG TMLAEDCFSF PRQQMGLEIE LNLADRAGLP        60
     AMRNAEVLEK IDDPAFTLEL GQHNLELNVP PRELAGDHTL GLERDLRALL GVADAKAQDA       120
     GASLVMIGVL PTLRPEHFDR RWLSHNPRYS LLNDQIFAAR GEELVLSLEG APLPGRDAER       180
     LLSRSESILP EAACTSVQLH LQVAPEDFAA HWNAAQCLAG VQVAIAANSP FLLGRALWHE       240
     TRIPLFQQAT DTRPQELQNQ GVRPRVWFGE RWITSIFDLF EENVRYFPAL LPETGDEDPV       300
     DVLGSGGTPR MTELRLHNGT VWRWNRPVYD VVAGVPHLRI ENRVLPAGPT VLDTLANAAF       360
     FYGAQRALSS MDRPLWTQMS FQAAEENLYA GARHGMNAQL YWPGIGWVPP DELVLRRLLP       420
     LAHEGLRDCG VSDEARERYL GVIEARCLAG RTGALWQREV VAGLEERGAG REGALAGMLA       480
     RYVERMHEGE PVHTWSV                                                      497
//

If you have problems or comments...

PBIL Back to PBIL home page