(data stored in ACNUC7421 zone)

EMBL: CP001630.PE489

CP001630.PE489       Location/Qualifiers
FT   CDS             535700..536551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0496"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   mes:Meso_2208 tRNA/rRNA methyltransferase (SpoU)"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34463"
FT                   /db_xref="GOA:C6WI12"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI12"
FT                   /inference="protein motif:PFAM:PF00588"
FT                   /protein_id="ACU34463.1"
FT                   /translation="MQVTGLRFRPLDYERHSQCETVRVAEVIEIDDPDDPRLDDFRDLS
FT                   TADRRPDRPGGRGLVIAEGVVVVERLLASPYPVRAVLGVRRRVEALGELPAPAYVASAD
FT                   VMARVVGFHLNRGVLAAADRAPQPSLDELATGRRLAVLEGVGDHENLGALFRNAAALGI
FT                   DGVVLGPGCSDPLYRRSVRVSMGHVLRVPFAAVDDWPGGLKLLQDKGFVVAALTPRVGS
FT                   VELPDAGLRGRRVAVLLGSEGPGLTEEAIGAADVAVRIPMSPGVDSLNVATAAAVAFYA
FT                   IA"
     MQVTGLRFRP LDYERHSQCE TVRVAEVIEI DDPDDPRLDD FRDLSTADRR PDRPGGRGLV        60
     IAEGVVVVER LLASPYPVRA VLGVRRRVEA LGELPAPAYV ASADVMARVV GFHLNRGVLA       120
     AADRAPQPSL DELATGRRLA VLEGVGDHEN LGALFRNAAA LGIDGVVLGP GCSDPLYRRS       180
     VRVSMGHVLR VPFAAVDDWP GGLKLLQDKG FVVAALTPRV GSVELPDAGL RGRRVAVLLG       240
     SEGPGLTEEA IGAADVAVRI PMSPGVDSLN VATAAAVAFY AIA                         283
//

If you have problems or comments...

PBIL Back to PBIL home page