(data stored in ACNUC7421 zone)

EMBL: CP001630.PE49

CP001630.PE49        Location/Qualifiers
FT   CDS             52353..54134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0049"
FT                   /product="Gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.2"
FT                   /note="PFAM: gamma-glutamyltranspeptidase; KEGG:
FT                   bbt:BBta_2852 putative gamma- glutamyltranspeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34023"
FT                   /db_xref="GOA:C6WCK2"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCK2"
FT                   /inference="protein motif:PRIAM:2.3.2.2"
FT                   /protein_id="ACU34023.1"
FT                   /translation="MFTTRPELAGTHGMVASTHWLASSAGMAVLEDGGNAFDAAVAAGF
FT                   VLQVVEPHLNGPGGEVPALFSVRGGAPRVLCGQGTAPAAATPAHYRDLGLDLVPGSGLL
FT                   AATVPGAWDGWLTLLRDHGTKSLREVLGHAIGYARDGFPLLARVPVTIAAVADLFRDHW
FT                   TTSADLWLPGGKPPVAGERFRNPKLADTWEWLLAAGEAAGADREAQIEAARRAWSQGFV
FT                   AAQVEEFCRTAHRDDSGRDHAGVLTGQDMAGWEASYEEPVTADFGDWTVAKIGAWSQGP
FT                   ALLQQLRLLEGFADRLEYVDGAPTAETVHLAVECAKLAFADREAWYGDSADVPLEALLS
FT                   REYAAERRALVGERASLELRPGAPGGAEAVLAQHIRRGPSVAEELGGAVGEPTVSRTGA
FT                   VRGDTVHVDVVDRWGNIVSATPSGGWLQSSPTIPSLGFCLGSRAQMFWLDEGLPNSLAP
FT                   GKRPRITLSPSLALRGGEAVLAFGTPGGDQQDQWQLGFWLAHAVGGMNLQEAIDSPMWH
FT                   SNAFPSSFYPRAWTPGELVVESRAHGLDELRERGHSVVDAGPWALGRMSAVSRDPRSGL
FT                   LRAGANARGAQGYAVGR"
     MFTTRPELAG THGMVASTHW LASSAGMAVL EDGGNAFDAA VAAGFVLQVV EPHLNGPGGE        60
     VPALFSVRGG APRVLCGQGT APAAATPAHY RDLGLDLVPG SGLLAATVPG AWDGWLTLLR       120
     DHGTKSLREV LGHAIGYARD GFPLLARVPV TIAAVADLFR DHWTTSADLW LPGGKPPVAG       180
     ERFRNPKLAD TWEWLLAAGE AAGADREAQI EAARRAWSQG FVAAQVEEFC RTAHRDDSGR       240
     DHAGVLTGQD MAGWEASYEE PVTADFGDWT VAKIGAWSQG PALLQQLRLL EGFADRLEYV       300
     DGAPTAETVH LAVECAKLAF ADREAWYGDS ADVPLEALLS REYAAERRAL VGERASLELR       360
     PGAPGGAEAV LAQHIRRGPS VAEELGGAVG EPTVSRTGAV RGDTVHVDVV DRWGNIVSAT       420
     PSGGWLQSSP TIPSLGFCLG SRAQMFWLDE GLPNSLAPGK RPRITLSPSL ALRGGEAVLA       480
     FGTPGGDQQD QWQLGFWLAH AVGGMNLQEA IDSPMWHSNA FPSSFYPRAW TPGELVVESR       540
     AHGLDELRER GHSVVDAGPW ALGRMSAVSR DPRSGLLRAG ANARGAQGYA VGR              593
//

If you have problems or comments...

PBIL Back to PBIL home page