(data stored in ACNUC7421 zone)

EMBL: CP001630.PE490

CP001630.PE490       Location/Qualifiers
FT   CDS             536593..537243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0497"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34464"
FT                   /db_xref="GOA:C6WI13"
FT                   /db_xref="InterPro:IPR024244"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI13"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34464.1"
FT                   /translation="MELRVQEGRAVLAGHDGAEEREVDPRSLPLGAGLADALHEWAKVA
FT                   EAVLRADSASEAPAGELVTRRGRQLAVRLAADMGTSVEFTDPVTGESQRVEAPSPEEEA
FT                   RGRHAATSTATGLSAVPGVGQHASVVDEPTPWGTGLTVTVFTAAVVAVTVVSLSLGLNE
FT                   TSGWLAVLANALVVGGISPSVWLGRKVPVWRWVSYGVVVGVVAAWVALLAALL"
     MELRVQEGRA VLAGHDGAEE REVDPRSLPL GAGLADALHE WAKVAEAVLR ADSASEAPAG        60
     ELVTRRGRQL AVRLAADMGT SVEFTDPVTG ESQRVEAPSP EEEARGRHAA TSTATGLSAV       120
     PGVGQHASVV DEPTPWGTGL TVTVFTAAVV AVTVVSLSLG LNETSGWLAV LANALVVGGI       180
     SPSVWLGRKV PVWRWVSYGV VVGVVAAWVA LLAALL                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page