(data stored in ACNUC7421 zone)

EMBL: CP001630.PE491

CP001630.PE491       Location/Qualifiers
FT   CDS             537256..538983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0498"
FT                   /product="peptidase S9 prolyl oligopeptidase active site
FT                   domain protein"
FT                   /note="PFAM: peptidase S9 prolyl oligopeptidase active site
FT                   domain protein; dienelactone hydrolase;
FT                   phospholipase/Carboxylesterase; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34465"
FT                   /db_xref="GOA:C6WI14"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI14"
FT                   /inference="protein motif:PFAM:PF00326"
FT                   /protein_id="ACU34465.1"
FT                   /translation="MELTAELVVSGLRVGGPAVSPDGRSVVFAARGVGDGAEERPEGLR
FT                   WCGEPAELVFRVGGQLCAVGASGPARVLADLPEGVRWHLPLASGEVALAVPGLGGASRL
FT                   SLLDPVSGVSRAVDLGDRHVAEAAQRPGGGPLAVLTWEGPGYDPGLLRPRLHLVELEGL
FT                   AVRDLGPVAAGAEGLAWWRSGDRWRLAHLALTPPGLQAGMAVFDAEVPESGAIVEHVNR
FT                   TAGMAACPLELVQVERGAPLVLVAAGLDTEVHRLGADGLTLLARHEARVERLAADGAGE
FT                   VVAAVVSRADAPPDVCSGPVGGDLTRVSDSRPELRGIRWGERRRLSCVAVDGVELDGLL
FT                   VLPPGKAEADGPFPMVVLPHGGPYDRHADGFALDWHPSAQWLAHAGFAALLPNPRGGSG
FT                   RGHEFAAAVAGRAGHEELGDLLALLDHVVGLGVADPERVGIAGWSHGGYLAAWAVATTD
FT                   RFAAALVGAGVSDWGRQGAEGEWGAFDAALACGEAEEHDPVARAGGIRVPVLVVHGAED
FT                   VNVPVSQAELLRDALVEHGVEHELVVYEGEGHVIEGVEQQVDLLERTREWFTRWLGVR"
     MELTAELVVS GLRVGGPAVS PDGRSVVFAA RGVGDGAEER PEGLRWCGEP AELVFRVGGQ        60
     LCAVGASGPA RVLADLPEGV RWHLPLASGE VALAVPGLGG ASRLSLLDPV SGVSRAVDLG       120
     DRHVAEAAQR PGGGPLAVLT WEGPGYDPGL LRPRLHLVEL EGLAVRDLGP VAAGAEGLAW       180
     WRSGDRWRLA HLALTPPGLQ AGMAVFDAEV PESGAIVEHV NRTAGMAACP LELVQVERGA       240
     PLVLVAAGLD TEVHRLGADG LTLLARHEAR VERLAADGAG EVVAAVVSRA DAPPDVCSGP       300
     VGGDLTRVSD SRPELRGIRW GERRRLSCVA VDGVELDGLL VLPPGKAEAD GPFPMVVLPH       360
     GGPYDRHADG FALDWHPSAQ WLAHAGFAAL LPNPRGGSGR GHEFAAAVAG RAGHEELGDL       420
     LALLDHVVGL GVADPERVGI AGWSHGGYLA AWAVATTDRF AAALVGAGVS DWGRQGAEGE       480
     WGAFDAALAC GEAEEHDPVA RAGGIRVPVL VVHGAEDVNV PVSQAELLRD ALVEHGVEHE       540
     LVVYEGEGHV IEGVEQQVDL LERTREWFTR WLGVR                                  575
//

If you have problems or comments...

PBIL Back to PBIL home page