(data stored in ACNUC7421 zone)

EMBL: CP001630.PE492

CP001630.PE492       Location/Qualifiers
FT   CDS             complement(539369..540679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0499"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; protein
FT                   of unknown function DUF894 DitE; KEGG: lpp:lpp1608
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34466"
FT                   /db_xref="GOA:C6WI15"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI15"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU34466.1"
FT                   /translation="MRRLLGKIAIDTRPLGIPAYRRLWVSTIVTAVGSQLTAVAVPKQV
FT                   YDITGSSAWVGVAAGVALVPLLVFGLYGGAVADVVDRRKLLLVTNTGIAVTSVLLWVQA
FT                   AVGMSSVWPVIALLGLQQVFFAANAPARTASIARLVPPEMIPAATSLGATVMTFGGVFG
FT                   PMAAGALMPVLGLPTLYLIDAVALTATIWAVWKLPPLPPLNAPSRHAGLRDVVDGFKYL
FT                   AVQKVLLASFLLDIIAMVFGMPRALFPEMAEQTFGDPPGGGWALGWLFAAMPLGGLLCG
FT                   LLSGWTSRISRHGAGVVLAVIAWGLFMLGFGLSNALWLAVLFLALGGAADIVSMVFRNA
FT                   ILQTAASDDMRGRMQGVFIVVVAGGPRLADLAHGTTGALIGPGPASAVGGVLVVIATVA
FT                   AAFLLPVVWRYRFTPEQLGPPAGKAGPAGPVGPAGKV"
     MRRLLGKIAI DTRPLGIPAY RRLWVSTIVT AVGSQLTAVA VPKQVYDITG SSAWVGVAAG        60
     VALVPLLVFG LYGGAVADVV DRRKLLLVTN TGIAVTSVLL WVQAAVGMSS VWPVIALLGL       120
     QQVFFAANAP ARTASIARLV PPEMIPAATS LGATVMTFGG VFGPMAAGAL MPVLGLPTLY       180
     LIDAVALTAT IWAVWKLPPL PPLNAPSRHA GLRDVVDGFK YLAVQKVLLA SFLLDIIAMV       240
     FGMPRALFPE MAEQTFGDPP GGGWALGWLF AAMPLGGLLC GLLSGWTSRI SRHGAGVVLA       300
     VIAWGLFMLG FGLSNALWLA VLFLALGGAA DIVSMVFRNA ILQTAASDDM RGRMQGVFIV       360
     VVAGGPRLAD LAHGTTGALI GPGPASAVGG VLVVIATVAA AFLLPVVWRY RFTPEQLGPP       420
     AGKAGPAGPV GPAGKV                                                       436
//

If you have problems or comments...

PBIL Back to PBIL home page