(data stored in ACNUC7421 zone)

EMBL: CP001630.PE493

CP001630.PE493       Location/Qualifiers
FT   CDS             540751..542352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0500"
FT                   /product="polysaccharide lyase family 8"
FT                   /note="PFAM: polysaccharide lyase family 8; polysaccharide
FT                   lyase 8 alpha-helical; KEGG: vvy:VVA1636 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34467"
FT                   /db_xref="GOA:C6WI16"
FT                   /db_xref="InterPro:IPR003159"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012970"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR038970"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI16"
FT                   /inference="protein motif:PFAM:PF02278"
FT                   /protein_id="ACU34467.1"
FT                   /translation="MSDLDVVRARLRPPHQPGPGLPPLPDGTWADIDYADHDAADFPPL
FT                   EHLRRALSLPDGQRLKALEAWRRLAPRSDNWWYNEIGAPRLVGDALLGADLDRAQRATW
FT                   GTWLAEQAGPVPMTGQNLVWAQGIELRRGLVEDDPELVRRAVARMSEVLRTGDGEGIQE
FT                   DLSFHQHGPQLYSGGYGASLVADLALWVRAVHGTPWAFGAAEVRLLADFLVDGQQWAVH
FT                   GGGFDFTTMGREIARADAHHRTADLRAAVLRLLECDPPRTAELTAFDDRLAGHGAPLVG
FT                   TRWYPRSDYLVHRRPGWSLSVRMSSGRTVPTECLNGENLLGRHLGDGVAALRLGDQAED
FT                   GYRSVLPVWDWARLPGVTTEQGRSLRPRPDQPRGGGEAIGWSDGENGVAALRLAGVEGF
FT                   TEGWKTWFCFADAVVALGAGITAPDAVGPVVTTIDQRLADHGSVTYVPMTTGHFSGVER
FT                   RTGSWRDLSGVESGRPVEADVFVMGFDHGPRPENASYACLIAPGDELPEVEVLANRVDR
FT                   QAVRCGSVVLERSMAG"
     MSDLDVVRAR LRPPHQPGPG LPPLPDGTWA DIDYADHDAA DFPPLEHLRR ALSLPDGQRL        60
     KALEAWRRLA PRSDNWWYNE IGAPRLVGDA LLGADLDRAQ RATWGTWLAE QAGPVPMTGQ       120
     NLVWAQGIEL RRGLVEDDPE LVRRAVARMS EVLRTGDGEG IQEDLSFHQH GPQLYSGGYG       180
     ASLVADLALW VRAVHGTPWA FGAAEVRLLA DFLVDGQQWA VHGGGFDFTT MGREIARADA       240
     HHRTADLRAA VLRLLECDPP RTAELTAFDD RLAGHGAPLV GTRWYPRSDY LVHRRPGWSL       300
     SVRMSSGRTV PTECLNGENL LGRHLGDGVA ALRLGDQAED GYRSVLPVWD WARLPGVTTE       360
     QGRSLRPRPD QPRGGGEAIG WSDGENGVAA LRLAGVEGFT EGWKTWFCFA DAVVALGAGI       420
     TAPDAVGPVV TTIDQRLADH GSVTYVPMTT GHFSGVERRT GSWRDLSGVE SGRPVEADVF       480
     VMGFDHGPRP ENASYACLIA PGDELPEVEV LANRVDRQAV RCGSVVLERS MAG              533
//

If you have problems or comments...

PBIL Back to PBIL home page