(data stored in ACNUC7421 zone)

EMBL: CP001630.PE494

CP001630.PE494       Location/Qualifiers
FT   CDS             complement(542596..543255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0501"
FT                   /product="pyridoxamine 5'-phosphate oxidase"
FT                   /EC_number="1.4.3.5"
FT                   /note="KEGG: rpi:Rpic_0717 pyridoxamine 5'-phosphate
FT                   oxidase; TIGRFAM: pyridoxamine 5'-phosphate oxidase; PFAM:
FT                   pyridoxamine 5'-phosphate oxidase-related FMN- binding"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34468"
FT                   /db_xref="GOA:C6WI17"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="InterPro:IPR019740"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI17"
FT                   /inference="protein motif:TFAM:TIGR00558"
FT                   /protein_id="ACU34468.1"
FT                   /translation="MSEATTSITLPAMRVSYERSALGEGDLAATWHEQLQLWLDEATNA
FT                   GLLEPNAMVLATADPSGRPSSRTVLAKGLDERGLVFFTNYTSAKSHDLMATRYASTTFP
FT                   WYGLQRQAHVRGTVEKVSHAETTEYWESRPRGSQLGAWASPQSRVVTGRPTLESALNKI
FT                   ERQFTDTERVPVPPHWGGWRIRPEEVEFWQGRQDRMHDRLRFRLGRDGWETERVAP"
     MSEATTSITL PAMRVSYERS ALGEGDLAAT WHEQLQLWLD EATNAGLLEP NAMVLATADP        60
     SGRPSSRTVL AKGLDERGLV FFTNYTSAKS HDLMATRYAS TTFPWYGLQR QAHVRGTVEK       120
     VSHAETTEYW ESRPRGSQLG AWASPQSRVV TGRPTLESAL NKIERQFTDT ERVPVPPHWG       180
     GWRIRPEEVE FWQGRQDRMH DRLRFRLGRD GWETERVAP                              219
//

If you have problems or comments...

PBIL Back to PBIL home page