(data stored in ACNUC7421 zone)

EMBL: CP001630.PE495

CP001630.PE495       Location/Qualifiers
FT   CDS             complement(543312..544157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0502"
FT                   /product="urease accessory protein UreD"
FT                   /note="KEGG: scl:sce6547 urease accessory protein UreD"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34469"
FT                   /db_xref="GOA:C6WI18"
FT                   /db_xref="InterPro:IPR002669"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI18"
FT                   /inference="similar to AA sequence:KEGG:sce6547"
FT                   /protein_id="ACU34469.1"
FT                   /translation="MKAFARLVAERNPNGRTVIREMRSATPLTLVPARGARSDAHALVH
FT                   LVSSITAPLGGDELELRITVGPGAALVLRGVAATVALPGHRPGGSRSRVLLEVAEGGSV
FT                   EHLPEPTVVTARADHEAVLEAELAEGARLRAREVLVLGRLGERPGRLTTTTSVRRGGPL
FT                   LRQSLTIGDERGGPDTVDTSPAGLAGRRVIGAEVLCWGEDPAGPVSGDWWSLVPLARGG
FT                   SLATALGDTVIEVERALTGACGSHPGSSELLTRSRARFRADGHTLRVRSHRPGGSAQDR
FT                   "
     MKAFARLVAE RNPNGRTVIR EMRSATPLTL VPARGARSDA HALVHLVSSI TAPLGGDELE        60
     LRITVGPGAA LVLRGVAATV ALPGHRPGGS RSRVLLEVAE GGSVEHLPEP TVVTARADHE       120
     AVLEAELAEG ARLRAREVLV LGRLGERPGR LTTTTSVRRG GPLLRQSLTI GDERGGPDTV       180
     DTSPAGLAGR RVIGAEVLCW GEDPAGPVSG DWWSLVPLAR GGSLATALGD TVIEVERALT       240
     GACGSHPGSS ELLTRSRARF RADGHTLRVR SHRPGGSAQD R                           281
//

If you have problems or comments...

PBIL Back to PBIL home page