(data stored in ACNUC7421 zone)

EMBL: CP001630.PE496

CP001630.PE496       Location/Qualifiers
FT   CDS             544235..544771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0503"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34470"
FT                   /db_xref="InterPro:IPR025326"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI19"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34470.1"
FT                   /translation="MSRTTTALVATAAILAAGGAAGASASAGASPEPVAAAASVPTCRS
FT                   AGLDIAFGEVQGTAGTTYREIALVNRGLRPCALRGFPGVSYVDQQGDQVGPAAERVGGP
FT                   GEVLVLPRGGTATADVGFVRVGNFDPEVCHPVPVWGVRVFPPDGTEPLYLPLDGEHGCA
FT                   DARVGSHLTVASVRS"
     MSRTTTALVA TAAILAAGGA AGASASAGAS PEPVAAAASV PTCRSAGLDI AFGEVQGTAG        60
     TTYREIALVN RGLRPCALRG FPGVSYVDQQ GDQVGPAAER VGGPGEVLVL PRGGTATADV       120
     GFVRVGNFDP EVCHPVPVWG VRVFPPDGTE PLYLPLDGEH GCADARVGSH LTVASVRS         178
//

If you have problems or comments...

PBIL Back to PBIL home page