(data stored in ACNUC7421 zone)

EMBL: CP001630.PE497

CP001630.PE497       Location/Qualifiers
FT   CDS             complement(544741..545454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0504"
FT                   /product="urease accessory protein UreG"
FT                   /note="TIGRFAM: urease accessory protein UreG; PFAM:
FT                   cobalamin synthesis protein P47K; KEGG: scl:sce6551 urease
FT                   accessory protein G"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34471"
FT                   /db_xref="GOA:C6WI20"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004400"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI20"
FT                   /inference="protein motif:TFAM:TIGR00101"
FT                   /protein_id="ACU34471.1"
FT                   /translation="MSADHGHGHGHAHPVNFDPTDAGHDPHVPAPDARRAVRIGIGGPV
FT                   GSGKTALTAALCRALGGRVDLAVVTNDIYTTEDADFLRRAGVLPTERIEAVQTGACPHT
FT                   AIRDDITANLDAVEELEQRFPGLELVIIESGGDNLTAVFSRGLADAQVFVVDVAGGDKV
FT                   PRKGGPGVTTADLLVINKTDLAPLVGADLGVMTADAHRMRGELPVIAQSLVETPDAPAV
FT                   AEWVLGQLRTLATVR"
     MSADHGHGHG HAHPVNFDPT DAGHDPHVPA PDARRAVRIG IGGPVGSGKT ALTAALCRAL        60
     GGRVDLAVVT NDIYTTEDAD FLRRAGVLPT ERIEAVQTGA CPHTAIRDDI TANLDAVEEL       120
     EQRFPGLELV IIESGGDNLT AVFSRGLADA QVFVVDVAGG DKVPRKGGPG VTTADLLVIN       180
     KTDLAPLVGA DLGVMTADAH RMRGELPVIA QSLVETPDAP AVAEWVLGQL RTLATVR          237
//

If you have problems or comments...

PBIL Back to PBIL home page