(data stored in ACNUC7421 zone)

EMBL: CP001630.PE498

CP001630.PE498       Location/Qualifiers
FT   CDS             complement(545444..546106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0505"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0974 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34472"
FT                   /db_xref="GOA:C6WI21"
FT                   /db_xref="InterPro:IPR002639"
FT                   /db_xref="InterPro:IPR038277"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI21"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0974"
FT                   /protein_id="ACU34472.1"
FT                   /translation="MELAALLLVDSRFPGGGHAHSGGLEEAVSRRLVTDEATLRGFLLG
FT                   RLRTAGALAAVFAAAAARAPDLAALLELDVELDARTPSPAQRRASRAQGRGIARAARRA
FT                   WPSERLEELLRAEPRPHHPVLTGLLVGDPGDAARVIAYQSASGPATAAIRLLGLDPFGV
FT                   NAVLAGLADDLGAVVADAVARAADPPAGLPAPGSTGLDLMAEAHDRHHQEEVRLFVS"
     MELAALLLVD SRFPGGGHAH SGGLEEAVSR RLVTDEATLR GFLLGRLRTA GALAAVFAAA        60
     AARAPDLAAL LELDVELDAR TPSPAQRRAS RAQGRGIARA ARRAWPSERL EELLRAEPRP       120
     HHPVLTGLLV GDPGDAARVI AYQSASGPAT AAIRLLGLDP FGVNAVLAGL ADDLGAVVAD       180
     AVARAADPPA GLPAPGSTGL DLMAEAHDRH HQEEVRLFVS                             220
//

If you have problems or comments...

PBIL Back to PBIL home page