(data stored in ACNUC7421 zone)

EMBL: CP001630.PE499

CP001630.PE499       Location/Qualifiers
FT   CDS             complement(546215..547912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0506"
FT                   /product="urease, alpha subunit"
FT                   /note="TIGRFAM: urease, alpha subunit; PFAM:
FT                   amidohydrolase; Urease alpha-subunit domain protein; KEGG:
FT                   ank:AnaeK_0975 urease, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34473"
FT                   /db_xref="GOA:C6WI22"
FT                   /db_xref="InterPro:IPR005848"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011612"
FT                   /db_xref="InterPro:IPR017950"
FT                   /db_xref="InterPro:IPR017951"
FT                   /db_xref="InterPro:IPR029754"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI22"
FT                   /inference="protein motif:TFAM:TIGR01792"
FT                   /protein_id="ACU34473.1"
FT                   /translation="MTRVDRERYAELLGPTTGDRVRLADTDLLITVTDDLCRGAGSGDE
FT                   VIFGGGKVIRESMGQGMATRAEGAPDLVITGAVVLDHWGVVKADVGVRDGRITAIGKAG
FT                   NPDVMDGVHPDLVIGPSTEVLSGNGKILTAGGVDCHVHFICPQIVDTALASGLTTLIGG
FT                   GTGPAEGTKATTVTPGAWNLGRMLAAMDHMPVNVLLLGKGNTAREDALREQLLGGAGGF
FT                   KLHEDWGTTPVAIDTALRIADESGVQVAIHTDTLNEAGFLESTLDAIAGRSINAYHSEG
FT                   AGGGHAPDIIQVVSEPNVLPSSTNPTRPHTVNTLEEHLDMLMVCHHLNPSVPEDLAFAE
FT                   SRIRPTTIAAEDVLHDLGAISMISSDSQAMGRVGEVITRTWQTAHVMHGRRGELAENLR
FT                   ARRYVAKYTINPAIAHGIDHEVGSVEAGKLADLVLWEPKFFGVRPSVVLKGGFIAWAAM
FT                   GDANASIPTPQPVLARPMFGAHAAARGSVHFVSQQAVDADLADLLRLSRPLVPVRGTRA
FT                   VGKADMVLNDALPHVRVDPDSFAVTVDGELVEPEPVERLPMAQRYFLF"
     MTRVDRERYA ELLGPTTGDR VRLADTDLLI TVTDDLCRGA GSGDEVIFGG GKVIRESMGQ        60
     GMATRAEGAP DLVITGAVVL DHWGVVKADV GVRDGRITAI GKAGNPDVMD GVHPDLVIGP       120
     STEVLSGNGK ILTAGGVDCH VHFICPQIVD TALASGLTTL IGGGTGPAEG TKATTVTPGA       180
     WNLGRMLAAM DHMPVNVLLL GKGNTAREDA LREQLLGGAG GFKLHEDWGT TPVAIDTALR       240
     IADESGVQVA IHTDTLNEAG FLESTLDAIA GRSINAYHSE GAGGGHAPDI IQVVSEPNVL       300
     PSSTNPTRPH TVNTLEEHLD MLMVCHHLNP SVPEDLAFAE SRIRPTTIAA EDVLHDLGAI       360
     SMISSDSQAM GRVGEVITRT WQTAHVMHGR RGELAENLRA RRYVAKYTIN PAIAHGIDHE       420
     VGSVEAGKLA DLVLWEPKFF GVRPSVVLKG GFIAWAAMGD ANASIPTPQP VLARPMFGAH       480
     AAARGSVHFV SQQAVDADLA DLLRLSRPLV PVRGTRAVGK ADMVLNDALP HVRVDPDSFA       540
     VTVDGELVEP EPVERLPMAQ RYFLF                                             565
//

If you have problems or comments...

PBIL Back to PBIL home page