(data stored in ACNUC7421 zone)

EMBL: CP001630.PE5

CP001630.PE5         Location/Qualifiers
FT   CDS             6031..6462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0005"
FT                   /product="protein of unknown function DUF721"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   protein of unknown function DUF721"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33979"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCF8"
FT                   /inference="protein motif:PFAM:PF05258"
FT                   /protein_id="ACU33979.1"
FT                   /translation="MRSRRATGGAAARRRRRTWSGPGPDDRDPQPLGRLASRIAADRGW
FT                   AEKLRGGQVIAQWPKLVGEDVAEHAQPVSFEDGELTVQADSTAWATQLRLLQRELLKKI
FT                   AAGLGPNVVKRLKVLGPAAPSWRYGPRHVSGRGPRDTYG"
     MRSRRATGGA AARRRRRTWS GPGPDDRDPQ PLGRLASRIA ADRGWAEKLR GGQVIAQWPK        60
     LVGEDVAEHA QPVSFEDGEL TVQADSTAWA TQLRLLQREL LKKIAAGLGP NVVKRLKVLG       120
     PAAPSWRYGP RHVSGRGPRD TYG                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page