(data stored in ACNUC7421 zone)

EMBL: CP001630.PE50

CP001630.PE50        Location/Qualifiers
FT   CDS             complement(54212..54541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34024"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCK3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34024.1"
FT                   /translation="MNLRKTVTGALLGLGSAAAMLGLGGTAMAADTIDITTTANPDIDA
FT                   HAPDAVKVGEIVDLDINEISDINLNVLDDDNVDADVFAHDLQALVNNGDLPADALVHLL
FT                   IEGND"
     MNLRKTVTGA LLGLGSAAAM LGLGGTAMAA DTIDITTTAN PDIDAHAPDA VKVGEIVDLD        60
     INEISDINLN VLDDDNVDAD VFAHDLQALV NNGDLPADAL VHLLIEGND                   109
//

If you have problems or comments...

PBIL Back to PBIL home page