(data stored in ACNUC7421 zone)

EMBL: CP001630.PE500

CP001630.PE500       Location/Qualifiers
FT   CDS             complement(547909..548220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0507"
FT                   /product="urease, beta subunit"
FT                   /EC_number="3.5.1.5"
FT                   /note="KEGG: atu:Atu2405 urease subunit beta; TIGRFAM:
FT                   urease, beta subunit; PFAM: Urease beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34474"
FT                   /db_xref="GOA:C6WI23"
FT                   /db_xref="InterPro:IPR002019"
FT                   /db_xref="InterPro:IPR036461"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI23"
FT                   /inference="protein motif:TFAM:TIGR00192"
FT                   /protein_id="ACU34474.1"
FT                   /translation="MRPGEIIPGEEPVELNPGRPRTTLVVVNGGDRPVQVGSHYHFAAV
FT                   NPGLLFDRDAAWGKRLDVPAGTAVRFEPGVEREVVLVPLAGRRVVPGLRPEHAGELDR"
     MRPGEIIPGE EPVELNPGRP RTTLVVVNGG DRPVQVGSHY HFAAVNPGLL FDRDAAWGKR        60
     LDVPAGTAVR FEPGVEREVV LVPLAGRRVV PGLRPEHAGE LDR                         103
//

If you have problems or comments...

PBIL Back to PBIL home page