(data stored in ACNUC7421 zone)

EMBL: CP001630.PE501

CP001630.PE501       Location/Qualifiers
FT   CDS             complement(548279..548581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0508"
FT                   /product="urease, gamma subunit"
FT                   /EC_number="3.5.1.5"
FT                   /note="KEGG: oan:Oant_0332 urease, gamma subunit; TIGRFAM:
FT                   urease, gamma subunit; PFAM: Urease gamma subunit region"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34475"
FT                   /db_xref="GOA:C6WI24"
FT                   /db_xref="InterPro:IPR002026"
FT                   /db_xref="InterPro:IPR012010"
FT                   /db_xref="InterPro:IPR036463"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI24"
FT                   /inference="protein motif:TFAM:TIGR00193"
FT                   /protein_id="ACU34475.1"
FT                   /translation="MHLTPHERDKLLVHVAADVARRRLERGVALNHPESVALITSHVLE
FT                   GARDGRTVGELMASGRHVLTREQVMDGVPEMIDSVQVEATFPDGTKLVTVHDPIS"
     MHLTPHERDK LLVHVAADVA RRRLERGVAL NHPESVALIT SHVLEGARDG RTVGELMASG        60
     RHVLTREQVM DGVPEMIDSV QVEATFPDGT KLVTVHDPIS                             100
//

If you have problems or comments...

PBIL Back to PBIL home page