(data stored in ACNUC7421 zone)

EMBL: CP001630.PE502

CP001630.PE502       Location/Qualifiers
FT   CDS             548814..549929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0509"
FT                   /product="Citrate (Si)-synthase"
FT                   /EC_number="2.3.3.1"
FT                   /note="PFAM: Citrate synthase; KEGG: pzu:PHZ_c0162 citrate
FT                   synthase GltA"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34476"
FT                   /db_xref="GOA:C6WI25"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI25"
FT                   /inference="protein motif:PRIAM:2.3.3.1"
FT                   /protein_id="ACU34476.1"
FT                   /translation="MVQQAEQDGFKPGLEGVVAFRTEIAEPDRDGGALRYRGVDIEELA
FT                   GRVTFGDVWALLVDGAFGAGLVPAEPFPIPVHTGDVRVDVQAALAMVAPIWGFQPLLDI
FT                   PEREARDQLARASVMALSYVAQSARGTGRPAVPQHRVDQCATITDRFLTRWRGEPDPAH
FT                   VRALDAYWVSAAEHGLNASTFTARVIASTGADVAAAMSGAIGAMSGPLHGGAPARVLPM
FT                   IEAVERKGDARGYVRGVLDRGERLMGFGHRVYRAEDPRARVLRRTCKELDAPRYEAAAA
FT                   LEQAALAELRERRPDRAIETNVEFWAAVVLDFAEVPPAIMPAMFTCARTAGWSAHILEQ
FT                   KRTGRLVRPSAAYIGPEARSVESVEGWDEIA"
     MVQQAEQDGF KPGLEGVVAF RTEIAEPDRD GGALRYRGVD IEELAGRVTF GDVWALLVDG        60
     AFGAGLVPAE PFPIPVHTGD VRVDVQAALA MVAPIWGFQP LLDIPEREAR DQLARASVMA       120
     LSYVAQSARG TGRPAVPQHR VDQCATITDR FLTRWRGEPD PAHVRALDAY WVSAAEHGLN       180
     ASTFTARVIA STGADVAAAM SGAIGAMSGP LHGGAPARVL PMIEAVERKG DARGYVRGVL       240
     DRGERLMGFG HRVYRAEDPR ARVLRRTCKE LDAPRYEAAA ALEQAALAEL RERRPDRAIE       300
     TNVEFWAAVV LDFAEVPPAI MPAMFTCART AGWSAHILEQ KRTGRLVRPS AAYIGPEARS       360
     VESVEGWDEI A                                                            371
//

If you have problems or comments...

PBIL Back to PBIL home page