(data stored in ACNUC7421 zone)

EMBL: CP001630.PE503

CP001630.PE503       Location/Qualifiers
FT   CDS             550082..550912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0510"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sus:Acid_0079 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34477"
FT                   /db_xref="GOA:C6WI26"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI26"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACU34477.1"
FT                   /translation="MTAAISARGLRKSYGDFEAVRGVDLEVAEGEVFALLGPNGAGKST
FT                   TVEILEGLRPRTGGEVSVLGADPATAPRSWRAGIGVVQQAATDLADITVAEAVHHHARY
FT                   YPDPRDPDEVVALVGLADKARTRAGRLSGGQRRRLDVALGIIGRPRVLFLDEPTTGFDP
FT                   EARRQFWGLVRDLAREGATILLTTHYLDEVEALADRLAVIAGGRLVAEGTPTTVGGRDR
FT                   AKALVTWVDPDGVQRSRATTDPVALVVELNALGPVADLTVTRPTLEDVYLELIA"
     MTAAISARGL RKSYGDFEAV RGVDLEVAEG EVFALLGPNG AGKSTTVEIL EGLRPRTGGE        60
     VSVLGADPAT APRSWRAGIG VVQQAATDLA DITVAEAVHH HARYYPDPRD PDEVVALVGL       120
     ADKARTRAGR LSGGQRRRLD VALGIIGRPR VLFLDEPTTG FDPEARRQFW GLVRDLAREG       180
     ATILLTTHYL DEVEALADRL AVIAGGRLVA EGTPTTVGGR DRAKALVTWV DPDGVQRSRA       240
     TTDPVALVVE LNALGPVADL TVTRPTLEDV YLELIA                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page