(data stored in ACNUC7421 zone)

EMBL: CP001630.PE504

CP001630.PE504       Location/Qualifiers
FT   CDS             550909..551709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0511"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: mxa:MXAN_1598
FT                   ABC transporter, permease protein, ABC-2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34478"
FT                   /db_xref="GOA:C6WI27"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI27"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ACU34478.1"
FT                   /translation="MRTAALGLARGGLELRQFFRNTAGFLFTFALPVFLLLLLGSIFSG
FT                   MTPSGADFTQEQEFTAGMLGAGIISTTFITLGAGIAQDRENGTLKRLHGTPLPLASYFI
FT                   GKIVMVLVLSLAEAVLVLITGVLVFDVDLPTDPARWFTFAWVFALGTVSCALLGIAVSS
FT                   VAGSARSAPTVLNLPYVGLQFVSGVFISIAVLPQWMVVLGSLFPLKWVAQGFRSVLLPE
FT                   GAAVVEVAGAWEHGRIALVLAGWCVAGLVLCAASFRWTNGRSGG"
     MRTAALGLAR GGLELRQFFR NTAGFLFTFA LPVFLLLLLG SIFSGMTPSG ADFTQEQEFT        60
     AGMLGAGIIS TTFITLGAGI AQDRENGTLK RLHGTPLPLA SYFIGKIVMV LVLSLAEAVL       120
     VLITGVLVFD VDLPTDPARW FTFAWVFALG TVSCALLGIA VSSVAGSARS APTVLNLPYV       180
     GLQFVSGVFI SIAVLPQWMV VLGSLFPLKW VAQGFRSVLL PEGAAVVEVA GAWEHGRIAL       240
     VLAGWCVAGL VLCAASFRWT NGRSGG                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page