(data stored in ACNUC7421 zone)

EMBL: CP001630.PE505

CP001630.PE505       Location/Qualifiers
FT   CDS             551682..552701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0512"
FT                   /product="histidine kinase"
FT                   /note="PFAM: histidine kinase dimerization and
FT                   phosphoacceptor region; ATP-binding region ATPase domain
FT                   protein; KEGG: sus:Acid_1273 integral membrane sensor
FT                   signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34479"
FT                   /db_xref="GOA:C6WI28"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI28"
FT                   /inference="protein motif:PFAM:PF07730"
FT                   /protein_id="ACU34479.1"
FT                   /translation="MDERAKWGLITGAGLLVAACGALLPDVTAERHWAAVAVIAVIAAW
FT                   VLLQPRQLYLIGLHALTVTAMWLSPGATFLLFAVLPEVYRRIPLRPAFWVMLAFVVPPW
FT                   LLSWARTGDPTSMLLVLLPTALFSQLFGWVIRTLAEQNLVIAELSHEAGVAAERERLSA
FT                   EIHDTLAQGFTSIVTLVQAARADPVRADDHLDLALRTARENLAESRALVAALAPAALEG
FT                   SLADALRRQVERVADFGVRAEFAERGAGEVPRAVEVVLLRAAQEALTNARRHAARVRVE
FT                   LDVLPDSVRLTVRDDGPGYRGAPEGFGLRGMRARLEQVGGTLTRSDDDGAVLVAEAPR"
     MDERAKWGLI TGAGLLVAAC GALLPDVTAE RHWAAVAVIA VIAAWVLLQP RQLYLIGLHA        60
     LTVTAMWLSP GATFLLFAVL PEVYRRIPLR PAFWVMLAFV VPPWLLSWAR TGDPTSMLLV       120
     LLPTALFSQL FGWVIRTLAE QNLVIAELSH EAGVAAERER LSAEIHDTLA QGFTSIVTLV       180
     QAARADPVRA DDHLDLALRT ARENLAESRA LVAALAPAAL EGSLADALRR QVERVADFGV       240
     RAEFAERGAG EVPRAVEVVL LRAAQEALTN ARRHAARVRV ELDVLPDSVR LTVRDDGPGY       300
     RGAPEGFGLR GMRARLEQVG GTLTRSDDDG AVLVAEAPR                              339
//

If you have problems or comments...

PBIL Back to PBIL home page