(data stored in ACNUC7421 zone)

EMBL: CP001630.PE506

CP001630.PE506       Location/Qualifiers
FT   CDS             552766..553395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0513"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; Sigma-70 region 4 type 2; SMART: response
FT                   regulator receiver; regulatory protein LuxR; KEGG:
FT                   sus:Acid_2683 two component LuxR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34480"
FT                   /db_xref="GOA:C6WI29"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI29"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACU34480.1"
FT                   /translation="MDGSEAVGGPVIRVLLVDDHPVVRQGVRGMLAPATDLEVVGEAAS
FT                   GDEAVRLVRADPPDVVLMDLRMPGGDGVEATARIGALSRVVVLTTYETDADILRAVEAG
FT                   AVGYLLKDASPEDLVAAVRAAARGETVLAPSVAGRLVRRTPALSPREVEVLRLVGRGLS
FT                   NAEIGRQLFIGEATVKTHLLRVFSKLDVSDRTAAVTTAMRLGLLGH"
     MDGSEAVGGP VIRVLLVDDH PVVRQGVRGM LAPATDLEVV GEAASGDEAV RLVRADPPDV        60
     VLMDLRMPGG DGVEATARIG ALSRVVVLTT YETDADILRA VEAGAVGYLL KDASPEDLVA       120
     AVRAAARGET VLAPSVAGRL VRRTPALSPR EVEVLRLVGR GLSNAEIGRQ LFIGEATVKT       180
     HLLRVFSKLD VSDRTAAVTT AMRLGLLGH                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page